PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID OGLUM04G14830.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
Family NAC
Protein Properties Length: 343aa    MW: 36804.7 Da    PI: 7.6435
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
OGLUM04G14830.1genomeOGEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM177.83e-55121371128
              NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkevls 94 
                      lppGfrFhPtdeel+++yL+kkv++ ++ +  +++e+d++k+ePwdLp+ +k +ekewyfF+ +d+ky+tg r+nrat+sgyWkatgkdk++++
  OGLUM04G14830.1  12 LPPGFRFHPTDEELITHYLAKKVADARFAA-LAVAEADLNKCEPWDLPSLAKMGEKEWYFFCLKDRKYPTGLRTNRATESGYWKATGKDKDIFR 104
                      79*************************999.67***************8888899*************************************** PP

              NAM  95 kkgelvglkktLvfykgrapkgektdWvmheyrl 128
                       +++lvg+kktLvfy+grapkgek+ Wvmheyrl
  OGLUM04G14830.1 105 -RKALVGMKKTLVFYTGRAPKGEKSGWVMHEYRL 137
                      .999****************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019418.76E-647168IPR003441NAC domain
PROSITE profilePS5100558.41412168IPR003441NAC domain
PfamPF023657.1E-3013137IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 343 aa     Download sequence    Send to blast
MEQHQGQAGM DLPPGFRFHP TDEELITHYL AKKVADARFA ALAVAEADLN KCEPWDLPSL  60
AKMGEKEWYF FCLKDRKYPT GLRTNRATES GYWKATGKDK DIFRRKALVG MKKTLVFYTG  120
RAPKGEKSGW VMHEYRLHGK LHAAALGLLH GKPASSKNEW VLCRVFKKSL VEVGAAGGKK  180
AAVVTMEMAR GGSTSSSVAD EIAMSSVVLP PLMDMSGAGA GAVDPATTAH VTCFSNALEG  240
QFFNPTAVHG HGGGDSSPFM ASFTQYGQLH HGVSLVQLLE SCNGYGGLVD MAASGSQLQP  300
AACGGERERL SASQDTGLTS DVNPEISSSS GQKFDHEAAL WGY
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3ulx_A6e-5421695169Stress-induced transcription factor NAC1
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00496DAPTransfer from AT5G07680Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAB0281810.0AB028181.1 Oryza sativa mRNA for OsNAC2 protein, complete cds.
GenBankAK0617450.0AK061745.1 Oryza sativa Japonica Group cDNA clone:001-038-F10, full insert sequence.
GenBankAK1046260.0AK104626.1 Oryza sativa Japonica Group cDNA clone:006-310-B03, full insert sequence.
GenBankCT8301070.0CT830107.1 Oryza sativa (indica cultivar-group) cDNA clone:OSIGCRA218A09, full insert sequence.
GenBankDQ5206410.0DQ520641.1 Oryza sativa (japonica cultivar-group) NAC domain protein (TIL1) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015633922.10.0PREDICTED: NAC domain-containing protein 92
RefseqXP_015633924.10.0PREDICTED: NAC domain-containing protein 92
SwissprotQ9FLR34e-97NAC79_ARATH; NAC domain-containing protein 79
TrEMBLA0A0D9ZLQ50.0A0A0D9ZLQ5_9ORYZ; Uncharacterized protein
TrEMBLA0A0E0H1Q20.0A0A0E0H1Q2_ORYNI; Uncharacterized protein
TrEMBLI1PLX80.0I1PLX8_ORYGL; Uncharacterized protein
STRINGORGLA04G0119700.10.0(Oryza glaberrima)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP27303787
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G07680.22e-77NAC domain containing protein 80